Lineage for d1qina_ (1qin A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132421Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 132422Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (4 families) (S)
  5. 132423Family d.32.1.1: Glyoxalase I (lactoylglutathione lyase) [54594] (1 protein)
  6. 132424Protein Glyoxalase I (lactoylglutathione lyase) [54595] (2 species)
  7. 132436Species Human (Homo sapiens) [TaxId:9606] [54596] (4 PDB entries)
  8. 132441Domain d1qina_: 1qin A: [38474]

Details for d1qina_

PDB Entry: 1qin (more details), 2 Å

PDB Description: human glyoxalase i complexed with s-(n-hydroxy-n-p-iodophenylcarbamoyl) glutathione

SCOP Domain Sequences for d1qina_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qina_ d.32.1.1 (A:) Glyoxalase I (lactoylglutathione lyase) {Human (Homo sapiens)}
ggltdeaalsccsdadpstkdfllqqtmlrvkdpkksldfytrvlgmtliqkcdfpimkf
slyflayedkndipkekdekiawalsrkatlelthnwgteddetqsyhngnsdprgfghi
giavpdvysackrfeelgvkfvkkpddgkmkglafiqdpdgywieilnpnkmatlm

SCOP Domain Coordinates for d1qina_:

Click to download the PDB-style file with coordinates for d1qina_.
(The format of our PDB-style files is described here.)

Timeline for d1qina_: