Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermotoga maritima [TaxId:243274] [224971] (9 PDB entries) |
Domain d6kcxa1: 6kcx A:1-181 [384649] Other proteins in same PDB: d6kcxa2, d6kcxa3 automated match to d1vjta1 complexed with cit, co, imd, ipa |
PDB Entry: 6kcx (more details), 1.93 Å
SCOPe Domain Sequences for d6kcxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kcxa1 c.2.1.0 (A:1-181) automated matches {Thermotoga maritima [TaxId: 243274]} mkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveelns pvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqel nmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganivgf c
Timeline for d6kcxa1: