SCOPe 2.08: Domain d6xvmb_: 6xvm B:

Lineage for d6xvmb_ (6xvm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein c-src protein tyrosine kinase [50064] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [50066] (28 PDB entries)

8. Domain d6xvmb_: 6xvm B: [384590]
   automated match to d3h0ha_
   complexed with gol

Details for d6xvmb_

PDB Entry: 6xvm, 0.9 Å

PDB Description: crystal structure of c-src sh3 domain without atcun motif: monomer 2

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d6xvmb_:

Sequence, based on SEQRES records:

>d6xvmb_ b.34.2.1 (B:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
gvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvapsd

Sequence, based on observed residues (ATOM records):

>d6xvmb_ b.34.2.1 (B:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
gvttfvalydyesrtetdlsfkkgerlqivnngdwwlahslttgqtgyipsnyvapsd

Timeline for d6xvmb_:

• d6xvmb_ first appeared in SCOPe 2.07