SCOPe 2.07: Domain d6wjob_: 6wjo B:

Lineage for d6wjob_ (6wjo B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.0: automated matches [194896] (1 protein)
   not a true family

6. Protein automated matches [194897] (4 species)
   not a true protein

7. Species Corynebacterium pseudotuberculosis [TaxId:681645] [384476] (2 PDB entries)

8. Domain d6wjob_: 6wjo B: [384498]
   automated match to d5jvoa_
   complexed with na, so4, tyr

Details for d6wjob_

PDB Entry: 6wjo, 1.69 Å

PDB Description: crystal structure of wild-type arginine repressor from the pathogenic bacterium corynebacterium pseudotuberculosis bound to tyrosine

PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d6wjob_:

Sequence; same for both SEQRES and ATOM records:

>d6wjob_ d.74.2.0 (B:) automated matches {Corynebacterium pseudotuberculosis [TaxId: 681645]}
reklrkmlddllvsvdhsgniavlrtppggapflasfidrvgmeevvgtiagddtvfvla
rdpmtgqelgeflsqr

Timeline for d6wjob_:

• d6wjob_ is new in SCOPe 2.07-stable
  
• d6wjob_ appears in the current release, SCOPe 2.08