Lineage for d6wjpb_ (6wjp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958117Family d.74.2.0: automated matches [194896] (1 protein)
    not a true family
  6. 2958118Protein automated matches [194897] (4 species)
    not a true protein
  7. 2958124Species Corynebacterium pseudotuberculosis [TaxId:681645] [384476] (2 PDB entries)
  8. 2958128Domain d6wjpb_: 6wjp B: [384495]
    automated match to d5jvoa_
    complexed with act, arg, gol, trs; mutant

Details for d6wjpb_

PDB Entry: 6wjp (more details), 1.7 Å

PDB Description: crystal structure of arginine repressor p115q mutant from the pathogenic bacterium corynebacterium pseudotuberculosis bound to arginine
PDB Compounds: (B:) Arginine repressor

SCOPe Domain Sequences for d6wjpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wjpb_ d.74.2.0 (B:) automated matches {Corynebacterium pseudotuberculosis [TaxId: 681645]}
gtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvfv
lardpmtgqelgeflsqrr

SCOPe Domain Coordinates for d6wjpb_:

Click to download the PDB-style file with coordinates for d6wjpb_.
(The format of our PDB-style files is described here.)

Timeline for d6wjpb_: