Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) forms trimers with three closely packed beta-sheets |
Family d.74.2.0: automated matches [194896] (1 protein) not a true family |
Protein automated matches [194897] (4 species) not a true protein |
Species Corynebacterium pseudotuberculosis [TaxId:681645] [384476] (2 PDB entries) |
Domain d6wjpb_: 6wjp B: [384495] automated match to d5jvoa_ complexed with act, arg, gol, trs; mutant |
PDB Entry: 6wjp (more details), 1.7 Å
SCOPe Domain Sequences for d6wjpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wjpb_ d.74.2.0 (B:) automated matches {Corynebacterium pseudotuberculosis [TaxId: 681645]} gtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvfv lardpmtgqelgeflsqrr
Timeline for d6wjpb_: