PDB entry 6wjp

View 6wjp on RCSB PDB site
Description: Crystal structure of Arginine Repressor P115Q mutant from the pathogenic bacterium Corynebacterium pseudotuberculosis bound to arginine
Class: DNA binding protein
Keywords: enzyme specificity, DNA BINDING PROTEIN
Deposited on 2020-04-14, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine repressor
    Species: Corynebacterium pseudotuberculosis (strain C231) [TaxId:681645]
    Gene: argR, CpC231_0953
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9QA55 (0-End)
      • engineered mutation (34)
    Domains in SCOPe 2.08: d6wjpa_
  • Chain 'B':
    Compound: Arginine repressor
    Species: Corynebacterium pseudotuberculosis (strain C231) [TaxId:681645]
    Gene: argR, CpC231_0953
    Database cross-references and differences (RAF-indexed):
    • Uniprot D9QA55
      • engineered mutation (34)
    Domains in SCOPe 2.08: d6wjpb_
  • Heterogens: ARG, ACT, GOL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6wjpA (A:)
vgtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvf
vlardpmtgqelgeflsqrrsgn

    Sequence, based on observed residues (ATOM records): (download) 
    >6wjpA (A:)
vgtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvf
vlardpmtgqelgeflsqrr

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6wjpB (B:)
vgtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvf
vlardpmtgqelgeflsqrrsgn

    Sequence, based on observed residues (ATOM records): (download) 
    >6wjpB (B:)
gtreklrkmlddllvsvdhsgniavlrtppggaqflasfidrvgmeevvgtiagddtvfv
lardpmtgqelgeflsqrr