SCOPe 2.08: Domain d6ox7d1: 6ox7 D:435-597

Lineage for d6ox7d1 (6ox7 D:435-597)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family)
   Pfam PF16454

5. Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)

6. Protein automated matches [310859] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311240] (9 PDB entries)

8. Domain d6ox7d1: 6ox7 D:435-597 [384238]
   Other proteins in same PDB: d6ox7a_, d6ox7b_, d6ox7d2
   automated match to d3l4qc_

Details for d6ox7d1

PDB Entry: 6ox7, 2.75 Å

PDB Description: the complex of 1918 ns1-ed and the ish2 domain of the human p85beta subunit of pi3k

PDB Compounds: (D:) Phosphatidylinositol 3-kinase regulatory subunit beta

SCOPe Domain Sequences for d6ox7d1:

Sequence, based on SEQRES records:

>d6ox7d1 h.4.21.1 (D:435-597) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeq
gqtqeksskeylerfrregnekemqrillnserlksriaeihesrtkleqqlraqasdnr
eidkrmnslkpdlmqlrkirdqylvwltqkgarqkkinewlgi

Sequence, based on observed residues (ATOM records):

>d6ox7d1 h.4.21.1 (D:435-597) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kedsveavgaqlkvyhqqyqdksreydqlyeeytrtsqelqmkrtaieafnetikifeeq
gqtqeillnserlksriaeihesrtkleqqlraqasdnreidkrmnslkpdlmqlrkird
qylvwltqkgarqkkinewlgi

Timeline for d6ox7d1:

• d6ox7d1 first appeared in SCOPe 2.07