Lineage for d6utae_ (6uta E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2375406Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2375450Protein automated matches [190183] (10 species)
    not a true protein
  7. 2375484Species Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId:2043570] [377146] (2 PDB entries)
  8. 2375488Domain d6utae_: 6uta E: [383937]
    Other proteins in same PDB: d6utab1, d6utab2, d6utal1, d6utal2
    automated match to d5omza_

Details for d6utae_

PDB Entry: 6uta (more details), 3.1 Å

PDB Description: crystal structure of z004 igl fab in complex with zikv ediii
PDB Compounds: (E:) Env

SCOPe Domain Sequences for d6utae_:

Sequence, based on SEQRES records: (download)

>d6utae_ b.1.18.4 (E:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]}
syslctaaftftkipaetlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanp
vitestenskmmleldppfgdsyivigvgekkithhwhrsg

Sequence, based on observed residues (ATOM records): (download)

>d6utae_ b.1.18.4 (E:) automated matches {Zika virus zikv/h. sapiens/frenchpolynesia/10087pf/2013 [TaxId: 2043570]}
syslctaaftftkiptlhgtvtvevqyagtdgpckvpaqmavdmqtltpvgrlitanpvi
testenskmmleldppfgdsyivigvgekkithhwhrsg

SCOPe Domain Coordinates for d6utae_:

Click to download the PDB-style file with coordinates for d6utae_.
(The format of our PDB-style files is described here.)

Timeline for d6utae_: