![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.4: WD40 repeat-like [50978] (4 families) ![]() also contains 8-bladed propellers |
![]() | Family b.69.4.0: automated matches [191412] (1 protein) not a true family |
![]() | Protein automated matches [190568] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries) |
![]() | Domain d6ujja_: 6ujj A: [383851] automated match to d6ucsa_ complexed with qbp |
PDB Entry: 6ujj (more details), 1.73 Å
SCOPe Domain Sequences for d6ujja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ujja_ b.69.4.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl wksdc
Timeline for d6ujja_: