Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Red fluorescent protein (fp583 or dsred(clontech)) [54515] (1 species) |
Species Coral (Discosoma sp.) [TaxId:86600] [54516] (3 PDB entries) |
Domain d1ggxb_: 1ggx B: [38368] |
PDB Entry: 1ggx (more details), 1.9 Å
SCOPe Domain Sequences for d1ggxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggxb_ d.22.1.1 (B:) Red fluorescent protein (fp583 or dsred(clontech)) {Coral (Discosoma sp.) [TaxId: 86600]} vikefmrfkvrmegtvnghefeiegegegrpyeghntvklkvtkggplpfawdilspqfq ygskvyvkhpadipdykklsfpegfkwervmnfedggvvtvtqdsslqdgcfiykvkfig vnfpsdgpvmqkktmgweasterlyprdgvlkgeihkalklkdgghylvefksiymakkp vqlpgyyyvdsklditshnedytiveqyertegrhhlfl
Timeline for d1ggxb_: