SCOPe 2.07: Domain d6nhpe1: 6nhp E:11-325

Lineage for d6nhpe1 (6nhp E:11-325)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (57 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries)

8. Domain d6nhpe1: 6nhp E:11-325 [383676]
   Other proteins in same PDB: d6nhpa2, d6nhpb_, d6nhpc2, d6nhpd_, d6nhpe2, d6nhpf_
   automated match to d4xkga_
   complexed with bma, man, nag; mutant

Details for d6nhpe1

PDB Entry: 6nhp, 2.25 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha2 i45t mutant

PDB Compounds: (E:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d6nhpe1:

Sequence; same for both SEQRES and ATOM records:

>d6nhpe1 b.19.1.0 (E:11-325) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal
lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv
tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe
qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn
liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk
qntlklatgmrnvpe

Timeline for d6nhpe1:

• d6nhpe1 is new in SCOPe 2.07-stable
  
• d6nhpe1 appears in the current release, SCOPe 2.08