SCOPe 2.08: Domain d6kcna1: 6kcn A:78-228

Lineage for d6kcna1 (6kcn A:78-228)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.0: automated matches [191416] (1 protein)
not a true family
Protein automated matches [190576] (52 species)
not a true protein
Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)
Domain d6kcna1: 6kcn A:78-228 [383497]
Other proteins in same PDB: d6kcna2, d6kcnb2, d6kcnc2, d6kcnd2
automated match to d3bjua1
protein/RNA complex; complexed with d5f, gol, lys

Details for d6kcna1

PDB Entry: 6kcn (more details), 2.2 Å

PDB Description: crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 4

PDB Compounds: (A:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6kcna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kcna1 b.40.4.0 (A:78-228) automated matches {Plasmodium falciparum [TaxId: 5843]}
vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg
rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg
kskkgelsifpketillsaclhmlpmkyglk

SCOPe Domain Coordinates for d6kcna1:

Click to download the PDB-style file with coordinates for d6kcna1.
(The format of our PDB-style files is described here.)

Timeline for d6kcna1: