SCOPe 2.08: Domain d6ka6d1: 6ka6 D:79-228

Lineage for d6ka6d1 (6ka6 D:79-228)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries)

8. Domain d6ka6d1: 6ka6 D:79-228 [383382]
   Other proteins in same PDB: d6ka6a2, d6ka6b2, d6ka6c2, d6ka6d2
   automated match to d3bjua1
   protein/RNA complex; complexed with d4o, gol, lys

Details for d6ka6d1

PDB Entry: 6ka6, 1.89 Å

PDB Description: crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 1

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6ka6d1:

Sequence, based on SEQRES records:

>d6ka6d1 b.40.4.0 (D:79-228) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpmkyglk

Sequence, based on observed residues (ATOM records):

>d6ka6d1 b.40.4.0 (D:79-228) automated matches {Plasmodium falciparum [TaxId: 5843]}
dprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgr
imrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgk
skkgelsifpketillsaclhmlpmkyk

Timeline for d6ka6d1:

• d6ka6d1 first appeared in SCOPe 2.07