Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
Protein automated matches [196409] (46 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [230726] (37 PDB entries) |
Domain d6r39a_: 6r39 A: [383355] automated match to d2ogda_ complexed with bfh |
PDB Entry: 6r39 (more details), 2.6 Å
SCOPe Domain Sequences for d6r39a_:
Sequence, based on SEQRES records: (download)
>d6r39a_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes llslspnnngeeddgarrkrvlhdacvcgwmieflqahylveddimdnsvtrrgkpcwyr hpdvtvqcaindglllkswthmmamhffadrpflqdllcrfnrvdyttavgqlydvtsmf dsnkldpdvsqptttdfaeftlsnykrivkyktayytyllplvmglivsealptvdmgvt eelamlmgeyfqvqddvmdcftpperlgkvgtdiqdakcswlavtflakassaqvaefka nygsgdsekvatvrrlyeeadlqgdyvayeaavaeqvkelieklrlcspgfaasvetlwg ktyk
>d6r39a_ a.128.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} mpmqmfmqvydeiqmflleelelkfdmdpnrvrylrkmmdttclggkynrgltvidvaes llslspdgarrkrvlhdacvcgwmieflqahylveddimddvtvqcaindglllkswthm mamhffadrpflqdllcrfnrvdyttavgqlydvtsmfdfaeftlsnykrivkyktayyt yllplvmglivsealptvdmgvteelamlmgeyfqvqddvmdcftpperlgkvgtdiqda kcswlavtflakassaqvaefkanygsgdsekvatvrrlyeeadlqgdyvayeaavaeqv kelieklrlcspgfaasvetlwgktyk
Timeline for d6r39a_: