| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
| Family d.20.1.1: UBC-related [54496] (7 proteins) |
| Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
| Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries) |
| Domain d1fbvc_: 1fbv C: [38332] Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbva4 complexed with so4, zn |
PDB Entry: 1fbv (more details), 2.9 Å
SCOPe Domain Sequences for d1fbvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fbvc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky
Timeline for d1fbvc_:
View in 3DDomains from other chains: (mouse over for more information) d1fbva1, d1fbva2, d1fbva3, d1fbva4 |