Lineage for d1fbvc_ (1fbv C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021601Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)
  7. 1021709Species Human (Homo sapiens), ubch7 [TaxId:9606] [54502] (2 PDB entries)
  8. 1021711Domain d1fbvc_: 1fbv C: [38332]
    Other proteins in same PDB: d1fbva1, d1fbva2, d1fbva3, d1fbva4
    complexed with so4, zn

Details for d1fbvc_

PDB Entry: 1fbv (more details), 2.9 Å

PDB Description: structure of a cbl-ubch7 complex: ring domain function in ubiquitin- protein ligases
PDB Compounds: (C:) ubiquitin-conjugating enzyme e12-18 kda ubch7

SCOPe Domain Sequences for d1fbvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fbvc_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]}
srrlmkeleeirkcgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpaeypf
kppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpehplra
dlaeeyskdrkkfcknaeeftkky

SCOPe Domain Coordinates for d1fbvc_:

Click to download the PDB-style file with coordinates for d1fbvc_.
(The format of our PDB-style files is described here.)

Timeline for d1fbvc_: