Lineage for d1qcqa_ (1qcq A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 327088Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 327089Superfamily d.20.1: UBC-like [54495] (2 families) (S)
  5. 327090Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)
  6. 327091Protein Ubiquitin conjugating enzyme, UBC [54497] (14 species)
  7. 327108Species Baker's yeast (Saccharomyces cerevisiae), ubc4 [TaxId:4932] [54500] (1 PDB entry)
  8. 327109Domain d1qcqa_: 1qcq A: [38329]

Details for d1qcqa_

PDB Entry: 1qcq (more details), 2.7 Å

PDB Description: ubiquitin conjugating enzyme

SCOP Domain Sequences for d1qcqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcqa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc4}
mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd
ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl
vpeiahiyktdrpkyeatarewtkkyav

SCOP Domain Coordinates for d1qcqa_:

Click to download the PDB-style file with coordinates for d1qcqa_.
(The format of our PDB-style files is described here.)

Timeline for d1qcqa_: