Lineage for d1qcqa_ (1qcq A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily) Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family) 
Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein) Protein Ubiquitin conjugating enzyme [54497] (7 species) 
Species Baker's yeast (Saccharomyces cerevisiae), ubc4 [TaxId:4932] [54500] (1 PDB entry) 
Domain d1qcqa_: 1qcq A: [38329]
Details for d1qcqa_
PDB Entry: 1qcq (more details), 2.7 Å
PDB Description: ubiquitin conjugating enzyme
SCOP Domain Sequences for d1qcqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcqa_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc4}
mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd
ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl
vpeiahiyktdrpkyeatarewtkkyav
SCOP Domain Coordinates for d1qcqa_:
Click to download the PDB-style file with coordinates for d1qcqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qcqa_:
- d1qcqa_ appears in SCOP 1.57
- d1qcqa_ appears in the current release, SCOPe 2.08
View in 3D