SCOPe 2.07: Domain d6obcb_: 6obc B:

Lineage for d6obcb_ (6obc B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)

8. Domain d6obcb_: 6obc B: [383071]
   Other proteins in same PDB: d6obca_
   automated match to d4wenb_
   complexed with cl, edo

Details for d6obcb_

PDB Entry: 6obc, 1.76 Å

PDB Description: ricin a chain bound to camelid

PDB Compounds: (B:) VHH Antibody

SCOPe Domain Sequences for d6obcb_:

Sequence; same for both SEQRES and ATOM records:

>d6obcb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaetggglvqpggartlscaasesissfyfmgwyrqapgkprelvaeisnygrtdyg
dslkgrftisrdnaantvnlqmnnlapedtalyycnarkwersvledywgqgtqvtvss

Timeline for d6obcb_:

• d6obcb_ is new in SCOPe 2.07-stable
  
• d6obcb_ appears in the current release, SCOPe 2.08