Lineage for d6obcb_ (6obc B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356783Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries)
  8. 2356818Domain d6obcb_: 6obc B: [383071]
    Other proteins in same PDB: d6obca_
    automated match to d4wenb_
    complexed with cl, edo

Details for d6obcb_

PDB Entry: 6obc (more details), 1.76 Å

PDB Description: ricin a chain bound to camelid
PDB Compounds: (B:) VHH Antibody

SCOPe Domain Sequences for d6obcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6obcb_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
qvqlaetggglvqpggartlscaasesissfyfmgwyrqapgkprelvaeisnygrtdyg
dslkgrftisrdnaantvnlqmnnlapedtalyycnarkwersvledywgqgtqvtvss

SCOPe Domain Coordinates for d6obcb_:

Click to download the PDB-style file with coordinates for d6obcb_.
(The format of our PDB-style files is described here.)

Timeline for d6obcb_: