Lineage for d6juwv_ (6juw V:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2630428Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) (S)
    automatically mapped to Pfam PF02937
  5. 2630429Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)
  6. 2630430Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 2630431Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries)
  8. 2630479Domain d6juwv_: 6juw V: [382936]
    Other proteins in same PDB: d6juwa_, d6juwb1, d6juwb2, d6juwc_, d6juwd_, d6juwe_, d6juwf_, d6juwg_, d6juwh_, d6juwj_, d6juwk_, d6juwl_, d6juwm_, d6juwn_, d6juwo1, d6juwo2, d6juwp_, d6juwq_, d6juwr_, d6juws_, d6juwt_, d6juwu_, d6juww_, d6juwx_, d6juwy_, d6juwz_
    automated match to d1v54i_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d6juwv_

PDB Entry: 6juw (more details), 1.8 Å

PDB Description: bovine heart cytochrome c oxidase in catalitic intermediates at 1.80 angstrom resolution
PDB Compounds: (V:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d6juwv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6juwv_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

SCOPe Domain Coordinates for d6juwv_:

Click to download the PDB-style file with coordinates for d6juwv_.
(The format of our PDB-style files is described here.)

Timeline for d6juwv_: