Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Nostoc sp. [TaxId:103690] [382860] (1 PDB entry) |
Domain d6uffc_: 6uff C: [382911] automated match to d1q45a_ complexed with ca, fmn |
PDB Entry: 6uff (more details), 2.01 Å
SCOPe Domain Sequences for d6uffc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uffc_ c.1.4.0 (C:) automated matches {Nostoc sp. [TaxId: 103690]} stninlfssyqlgelelpnrivmapltrqragegnvphqlnaiyygqrasagliiaeatq vtpqgqgyphtpgihspeqvagwklvtdtvhqqggriflqlwhvgrishpdlqpdgglpv apsaiapkgevltyegkkpyvtpraldtseipaiveqyrqgaanalaagfdgveihaang ylidqflrdgtnqrtdeyggaienrarlllevteaitsvwdsqrvgvrlspsgtfndird shpletfgyvaqalnrfnlsylhifeaidadirhggtvvptshlrdrftgtlivnggytr ekgdtviankaadlvafgtlfisnpdlperlevnaplnqadpttfygggekgytdypfla va
Timeline for d6uffc_: