Lineage for d6uffc_ (6uff C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437285Species Nostoc sp. [TaxId:103690] [382860] (1 PDB entry)
  8. 2437288Domain d6uffc_: 6uff C: [382911]
    automated match to d1q45a_
    complexed with ca, fmn

Details for d6uffc_

PDB Entry: 6uff (more details), 2.01 Å

PDB Description: structure of ene-reductase 1 nostocer1 from cyanobacteria
PDB Compounds: (C:) Ene-reductase 1

SCOPe Domain Sequences for d6uffc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uffc_ c.1.4.0 (C:) automated matches {Nostoc sp. [TaxId: 103690]}
stninlfssyqlgelelpnrivmapltrqragegnvphqlnaiyygqrasagliiaeatq
vtpqgqgyphtpgihspeqvagwklvtdtvhqqggriflqlwhvgrishpdlqpdgglpv
apsaiapkgevltyegkkpyvtpraldtseipaiveqyrqgaanalaagfdgveihaang
ylidqflrdgtnqrtdeyggaienrarlllevteaitsvwdsqrvgvrlspsgtfndird
shpletfgyvaqalnrfnlsylhifeaidadirhggtvvptshlrdrftgtlivnggytr
ekgdtviankaadlvafgtlfisnpdlperlevnaplnqadpttfygggekgytdypfla
va

SCOPe Domain Coordinates for d6uffc_:

Click to download the PDB-style file with coordinates for d6uffc_.
(The format of our PDB-style files is described here.)

Timeline for d6uffc_: