Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Francisella tularensis [TaxId:401614] [382817] (1 PDB entry) |
Domain d6onta_: 6ont A: [382818] automated match to d1p6qa_ complexed with ca, cl, na |
PDB Entry: 6ont (more details), 1.8 Å
SCOPe Domain Sequences for d6onta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6onta_ c.23.1.0 (A:) automated matches {Francisella tularensis [TaxId: 401614]} npkvlvadddkkiaqfiktkfeengidttvafdgkealflintnnydvividwmmpyldg isllkilrkqnintpviilsaldstenkieglksgsddyltkpfsideliirvnilykrt k
Timeline for d6onta_: