Lineage for d6onta_ (6ont A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464246Species Francisella tularensis [TaxId:401614] [382817] (1 PDB entry)
  8. 2464247Domain d6onta_: 6ont A: [382818]
    automated match to d1p6qa_
    complexed with ca, cl, na

Details for d6onta_

PDB Entry: 6ont (more details), 1.8 Å

PDB Description: structure of the francisella response regulator 1452 receiver domain
PDB Compounds: (A:) Two-component response regulator 1452 receiver

SCOPe Domain Sequences for d6onta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6onta_ c.23.1.0 (A:) automated matches {Francisella tularensis [TaxId: 401614]}
npkvlvadddkkiaqfiktkfeengidttvafdgkealflintnnydvividwmmpyldg
isllkilrkqnintpviilsaldstenkieglksgsddyltkpfsideliirvnilykrt
k

SCOPe Domain Coordinates for d6onta_:

Click to download the PDB-style file with coordinates for d6onta_.
(The format of our PDB-style files is described here.)

Timeline for d6onta_: