Lineage for d6ttyi1 (6tty I:4-195)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461182Species Staphylococcus aureus [TaxId:93061] [189958] (9 PDB entries)
  8. 2461219Domain d6ttyi1: 6tty I:4-195 [382799]
    Other proteins in same PDB: d6ttyf2, d6ttyi2, d6ttyl2
    automated match to d3qwda_

Details for d6ttyi1

PDB Entry: 6tty (more details), 1.9 Å

PDB Description: structure of clpp from staphylococcus aureus (apo, closed state)
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6ttyi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ttyi1 c.14.1.1 (I:4-195) automated matches {Staphylococcus aureus [TaxId: 93061]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvpetk

SCOPe Domain Coordinates for d6ttyi1:

Click to download the PDB-style file with coordinates for d6ttyi1.
(The format of our PDB-style files is described here.)

Timeline for d6ttyi1: