SCOP 1.73: Domain d1de4d2: 1de4 D:4-181

Lineage for d1de4d2 (1de4 D:4-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains [88832] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54480] (2 PDB entries)

8. Domain d1de4d2: 1de4 D:4-181 [38278]
   Other proteins in same PDB: d1de4a1, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d1, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g1, d1de4h_, d1de4i1, d1de4i2, d1de4i3

Details for d1de4d2

PDB Entry: 1de4, 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

PDB Compounds: (D:) hemochromatosis protein

SCOP Domain Sequences for d1de4d2:

Sequence; same for both SEQRES and ATOM records:

>d1de4d2 d.19.1.1 (D:4-181) Hemochromatosis protein Hfe, alpha-1 and alpha-2 domains {Human (Homo sapiens) [TaxId: 9606]}
rshslhylfmgaseqdlglslfealgyvddqlfvfydhesrrveprtpwvssrissqmwl
qlsqslkgwdhmftvdfwtimenhnhskeshtlqvilgcemqednstegywkygydgqdh
lefcpdtldwraaeprawptklewerhkirarqnraylerdcpaqlqqllelgrgvld

Timeline for d1de4d2:

• d1de4d2 first appeared (with stable ids) in SCOP 1.55
  
• d1de4d2 appears in SCOP 1.71
  
• d1de4d2 appears in SCOP 1.75
  
• d1de4d2 appears in the current release, SCOPe 2.08