SCOP 1.73: Domain d1de4g1: 1de4 G:182-275

Lineage for d1de4g1 (1de4 G:182-275)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Hemochromatosis protein Hfe, alpha-3 domain [88608] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88609] (2 PDB entries)

8. Domain d1de4g1: 1de4 G:182-275 [20779]
   Other proteins in same PDB: d1de4a2, d1de4b_, d1de4c1, d1de4c2, d1de4c3, d1de4d2, d1de4e_, d1de4f1, d1de4f2, d1de4f3, d1de4g2, d1de4h_, d1de4i1, d1de4i2, d1de4i3

Details for d1de4g1

PDB Entry: 1de4, 2.8 Å

PDB Description: hemochromatosis protein hfe complexed with transferrin receptor

PDB Compounds: (G:) hemochromatosis protein

SCOP Domain Sequences for d1de4g1:

Sequence; same for both SEQRES and ATOM records:

>d1de4g1 b.1.1.2 (G:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qqvpplvkvthhvtssvttlrcralnyypqnitmkwlkdkqpmdakefepkdvlpngdgt
yqgwitlavppgeeqrytcqvehpgldqpliviw

Timeline for d1de4g1:

• d1de4g1 first appeared (with stable ids) in SCOP 1.55
  
• d1de4g1 appears in SCOP 1.71
  
• d1de4g1 appears in SCOP 1.75
  
• d1de4g1 appears in the current release, SCOPe 2.08