Lineage for d1a1na2 (1a1n A:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2182907Species Human (Homo sapiens), HLA-B35 [TaxId:9606] [54475] (13 PDB entries)
    Uniprot P30685 25-300
  8. 2182914Domain d1a1na2: 1a1n A:1-181 [38267]
    Other proteins in same PDB: d1a1na1, d1a1nb_

Details for d1a1na2

PDB Entry: 1a1n (more details), 2 Å

PDB Description: mhc class i molecule b*3501 complexed with peptide vplrpmty from the nef protein (75-82) of hiv1
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain

SCOPe Domain Sequences for d1a1na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1na2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B35 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyreslrnlrgyynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d1a1na2:

Click to download the PDB-style file with coordinates for d1a1na2.
(The format of our PDB-style files is described here.)

Timeline for d1a1na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a1na1
View in 3D
Domains from other chains:
(mouse over for more information)
d1a1nb_