Lineage for d6y1ed1 (6y1e D:1-76)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484529Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2484899Protein Class pi GST [81358] (4 species)
  7. 2484900Species Human (Homo sapiens) [TaxId:9606] [52864] (63 PDB entries)
  8. 2484918Domain d6y1ed1: 6y1e D:1-76 [382260]
    Other proteins in same PDB: d6y1ea2, d6y1eb2, d6y1ec2, d6y1ed2
    automated match to d13gsa2
    complexed with gsh, mes, o7z, pge

Details for d6y1ed1

PDB Entry: 6y1e (more details), 1.4 Å

PDB Description: crystal structure of human glutathione transferase p1-1 (hgstp1-1) that was co-crystallised in the presence of indanyloxyacetic acid-94 (iaa-94)
PDB Compounds: (D:) Glutathione S-transferase P

SCOPe Domain Sequences for d6y1ed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6y1ed1 c.47.1.5 (D:1-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtl

SCOPe Domain Coordinates for d6y1ed1:

Click to download the PDB-style file with coordinates for d6y1ed1.
(The format of our PDB-style files is described here.)

Timeline for d6y1ed1: