Lineage for d1es0a2 (1es0 A:1B-82)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545290Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2545361Species Mouse (Mus musculus), I-A(G7) [TaxId:10090] [88817] (4 PDB entries)
  8. 2545364Domain d1es0a2: 1es0 A:1B-82 [38217]
    Other proteins in same PDB: d1es0a1, d1es0a3, d1es0b1, d1es0b2, d1es0b3

Details for d1es0a2

PDB Entry: 1es0 (more details), 2.6 Å

PDB Description: crystal structure of the murine class ii allele i-a(g7) complexed with the glutamic acid decarboxylase (gad65) peptide 207-220
PDB Compounds: (A:) h-2 class II histocompatibility antigen

SCOPe Domain Sequences for d1es0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es0a2 d.19.1.1 (A:1B-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-A(G7) [TaxId: 10090]}
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqniaaekhnlgiltkrsnftpa

SCOPe Domain Coordinates for d1es0a2:

Click to download the PDB-style file with coordinates for d1es0a2.
(The format of our PDB-style files is described here.)

Timeline for d1es0a2: