Lineage for d6rkga_ (6rkg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928867Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 2928868Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 2928869Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 2928918Protein automated matches [279671] (2 species)
    not a true protein
  7. 2928944Species Sporosarcina pasteurii [TaxId:1474] [279673] (11 PDB entries)
  8. 2928945Domain d6rkga_: 6rkg A: [382162]
    Other proteins in same PDB: d6rkgb_
    automated match to d5g4ha_
    complexed with 2pa, edo, ni, so4

Details for d6rkga_

PDB Entry: 6rkg (more details), 1.32 Å

PDB Description: 1.32 a resolution of sporosarcina pasteurii urease inhibited in the presence of nbpto at ph 7.5
PDB Compounds: (A:) Urease subunit gamma

SCOPe Domain Sequences for d6rkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rkga_ d.8.1.1 (A:) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis

SCOPe Domain Coordinates for d6rkga_:

Click to download the PDB-style file with coordinates for d6rkga_.
(The format of our PDB-style files is described here.)

Timeline for d6rkga_: