SCOP 1.73: Domain d1iaoa2: 1iao A:1-82

Lineage for d1iaoa2 (1iao A:1-82)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AD [TaxId:10090] [88816] (2 PDB entries)

8. Domain d1iaoa2: 1iao A:1-82 [38215]
   Other proteins in same PDB: d1iaoa1, d1iaob1, d1iaob2
   complexed with nag

Details for d1iaoa2

PDB Entry: 1iao, 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339

PDB Compounds: (A:) MHC class II I-ad

SCOP Domain Sequences for d1iaoa2:

Sequence; same for both SEQRES and ATOM records:

>d1iaoa2 d.19.1.1 (A:1-82) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AD [TaxId: 10090]}
eadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqggl
qniaaekhnlgiltkrsnftpa

Timeline for d1iaoa2:

• d1iaoa2 first appeared (with stable ids) in SCOP 1.55
  
• d1iaoa2 appears in SCOP 1.71
  
• d1iaoa2 appears in SCOP 1.75
  
• d1iaoa2 appears in the current release, SCOPe 2.08