SCOP 1.73: Domain d1iaob1: 1iao B:94-188

Lineage for d1iaob1 (1iao B:94-188)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88631] (11 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d1iaob1: 1iao B:94-188 [21642]
   Other proteins in same PDB: d1iaoa1, d1iaoa2, d1iaob2
   complexed with nag

Details for d1iaob1

PDB Entry: 1iao, 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339

PDB Compounds: (B:) MHC class II I-ad

SCOP Domain Sequences for d1iaob1:

Sequence; same for both SEQRES and ATOM records:

>d1iaob1 b.1.1.2 (B:94-188) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
rleqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngd
wtfqvlvmlemtphqgevytchvehpslkspitvew

Timeline for d1iaob1:

• d1iaob1 first appeared (with stable ids) in SCOP 1.55
  
• d1iaob1 appears in SCOP 1.71
  
• d1iaob1 appears in SCOP 1.75
  
• d1iaob1 appears in the current release, SCOPe 2.08