Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) |
Family g.3.7.0: automated matches [335175] (1 protein) not a true family |
Protein automated matches [335176] (4 species) not a true protein |
Species Urodacus yaschenkoi [TaxId:1273102] [382109] (1 PDB entry) |
Domain d6mzta_: 6mzt A: [382110] automated match to d1wt7a_ |
PDB Entry: 6mzt (more details)
SCOPe Domain Sequences for d6mzta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mzta_ g.3.7.0 (A:) automated matches {Urodacus yaschenkoi [TaxId: 1273102]} gdikcsgtrqcwgpckkqttctnskcmngkckcygcv
Timeline for d6mzta_: