Lineage for d6mzta_ (6mzt A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635705Family g.3.7.0: automated matches [335175] (1 protein)
    not a true family
  6. 2635706Protein automated matches [335176] (4 species)
    not a true protein
  7. 2635714Species Urodacus yaschenkoi [TaxId:1273102] [382109] (1 PDB entry)
  8. 2635715Domain d6mzta_: 6mzt A: [382110]
    automated match to d1wt7a_

Details for d6mzta_

PDB Entry: 6mzt (more details)

PDB Description: solution structure of alpha-ktx-6.21 (urotx) from urodacus yaschenkoi
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 6.21

SCOPe Domain Sequences for d6mzta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mzta_ g.3.7.0 (A:) automated matches {Urodacus yaschenkoi [TaxId: 1273102]}
gdikcsgtrqcwgpckkqttctnskcmngkckcygcv

SCOPe Domain Coordinates for d6mzta_:

Click to download the PDB-style file with coordinates for d6mzta_.
(The format of our PDB-style files is described here.)

Timeline for d6mzta_: