Lineage for d6vebb3 (6veb B:216-457)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519173Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2519353Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species)
  7. 2519354Species Salmonella enterica [TaxId:59201] [381966] (1 PDB entry)
  8. 2519356Domain d6vebb3: 6veb B:216-457 [381970]
    Other proteins in same PDB: d6veba1, d6veba2, d6vebb1, d6vebb2
    automated match to d1pjta2
    complexed with cl, nad, pq2, sah

Details for d6vebb3

PDB Entry: 6veb (more details), 2.55 Å

PDB Description: precorrin-2-bound s128a s. typhimurium siroheme synthase
PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d6vebb3:

Sequence, based on SEQRES records: (download)

>d6vebb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella enterica [TaxId: 59201]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d6vebb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella enterica [TaxId: 59201]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrcvpq
eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay
sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm
pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d6vebb3:

Click to download the PDB-style file with coordinates for d6vebb3.
(The format of our PDB-style files is described here.)

Timeline for d6vebb3: