Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species) |
Species Salmonella enterica [TaxId:59201] [381966] (1 PDB entry) |
Domain d6vebb3: 6veb B:216-457 [381970] Other proteins in same PDB: d6veba1, d6veba2, d6vebb1, d6vebb2 automated match to d1pjta2 complexed with cl, nad, pq2, sah |
PDB Entry: 6veb (more details), 2.55 Å
SCOPe Domain Sequences for d6vebb3:
Sequence, based on SEQRES records: (download)
>d6vebb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella enterica [TaxId: 59201]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs nh
>d6vebb3 c.90.1.1 (B:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella enterica [TaxId: 59201]} gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrcvpq eeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsay sgiplthrdyaqsvrlvtgggeldwenlaaekqtlvfymglnqaatiqekliafgmqadm pvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh
Timeline for d6vebb3: