SCOPe 2.07: Domain d6qnee_: 6qne E:

Lineage for d6qnee_ (6qne E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.17: SOR-like [143278] (2 proteins)
   Pfam PF07682; duplication: consists of two similar domains

6. Protein automated matches [190550] (3 species)
   not a true protein

7. Species Acidianus ambivalens [TaxId:2283] [187530] (10 PDB entries)

8. Domain d6qnee_: 6qne E: [381793]
   automated match to d3bxva_
   complexed with fe

Details for d6qnee_

PDB Entry: 6qne, 1.8 Å

PDB Description: y102g mutated sulfur oxygenase reductase from acidianus ambivalens

PDB Compounds: (E:) Sulfur oxygenase/reductase

SCOPe Domain Sequences for d6qnee_:

Sequence; same for both SEQRES and ATOM records:

>d6qnee_ d.58.4.17 (E:) automated matches {Acidianus ambivalens [TaxId: 2283]}
pkpyvainmaelknepktfemfasvgpkvcmvtarhpgfvgfqnhiqigilpfgnrygga
kmdmtkesstvrvlqytfwkdwkdheemhrqnwsylfrlcgscasqmiwgpwepiyeiiy
anmpintemtdftavvgkkfaegkpldipvisqpygkrvvafaehsvipgkekqfedaiv
rtlemlkkapgflgamvlkeigvsgigsmqfgakgfhqvlenpgslepdpnnvmysvpea
kntpqqyivhvewantdalmfgmgrvllypelrqvhdevldtlvygpyirilnpmmegtf
wreylne

Timeline for d6qnee_:

• d6qnee_ is new in SCOPe 2.07-stable
  
• d6qnee_ appears in the current release, SCOPe 2.08