SCOP 1.59: Domain d2seba2: 2seb A:1-81

Lineage for d2seba2 (2seb A:1-81)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)

6. Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (6 PDB entries)

8. Domain d2seba2: 2seb A:1-81 [38167]
   Other proteins in same PDB: d2seba1, d2sebb1, d2sebd1, d2sebd2

Details for d2seba2

PDB Entry: 2seb, 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2seba2:

Sequence; same for both SEQRES and ATOM records:

>d2seba2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

Timeline for d2seba2:

• d2seba2 first appeared (with stable ids) in SCOP 1.55
  
• d2seba2 appears in SCOP 1.57
  
• d2seba2 appears in SCOP 1.61
  
• d2seba2 appears in the current release, SCOPe 2.08