Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins) |
Protein MHC class II, N-terminal domains of alpha and beta chains [54458] (11 species) |
Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [54460] (6 PDB entries) |
Domain d2seba2: 2seb A:1-81 [38167] Other proteins in same PDB: d2seba1, d2sebb1, d2sebd1, d2sebd2 |
PDB Entry: 2seb (more details), 2.5 Å
SCOP Domain Sequences for d2seba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2seba2 d.19.1.1 (A:1-81) MHC class II, N-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1} ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal aniavdkanleimtkrsnytp
Timeline for d2seba2:
View in 3D Domains from other chains: (mouse over for more information) d2sebb1, d2sebb2, d2sebd1, d2sebd2 |