Lineage for d6jksc2 (6jks C:158-326)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2514304Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2514305Protein automated matches [226938] (26 species)
    not a true protein
  7. 2514597Species Trypanosoma cruzi [TaxId:353153] [226636] (7 PDB entries)
  8. 2514651Domain d6jksc2: 6jks C:158-326 [381639]
    Other proteins in same PDB: d6jksb3, d6jksc3, d6jksd3, d6jksf3
    automated match to d4iv5a2
    complexed with asp, cp

Details for d6jksc2

PDB Entry: 6jks (more details), 2.1 Å

PDB Description: crystal structure of aspartate transcarbamoylase from trypanosoma cruzi in complex with carbamoyl phosphate (cp) and aspartate (asp)
PDB Compounds: (C:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d6jksc2:

Sequence, based on SEQRES records: (download)

>d6jksc2 c.78.1.0 (C:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqkerfmastsddaaalqsfaakaditidaarmrl
akekmivmhplprndelsttvdadpraayfrqmrygmfmrmailwsvla

Sequence, based on observed residues (ATOM records): (download)

>d6jksc2 c.78.1.0 (C:158-326) automated matches {Trypanosoma cruzi [TaxId: 353153]}
svdgitialigdlkmgrtvhsllkllvrnfsikcvflvapdalqmpqdvleplqheiatk
gviihrthaltdevmqksdvlyttrlqditidaarmrlakekmivmhplprndelsttvd
adpraayfrqmrygmfmrmailwsvla

SCOPe Domain Coordinates for d6jksc2:

Click to download the PDB-style file with coordinates for d6jksc2.
(The format of our PDB-style files is described here.)

Timeline for d6jksc2: