Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [381544] (6 PDB entries) |
Domain d6vd0b2: 6vd0 B:104-239 [381603] automated match to d1rg9a2 complexed with apc, k, met, mg, mpo, peg, pg4 |
PDB Entry: 6vd0 (more details), 2 Å
SCOPe Domain Sequences for d6vd0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vd0b2 d.130.1.0 (B:104-239) automated matches {Arabidopsis thaliana [TaxId: 3702]} aqgvhghftkrpedigagdqghmfgyatdetpelmplshvlatkigarltevrkngtcrw lrpdgktqvtveyyndngamvpvrvhtvlistqhdetvtndeiardlkehvikpiipeky lddktifhlnpsgrfv
Timeline for d6vd0b2: