Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [381544] (6 PDB entries) |
Domain d6vd2a2: 6vd2 A:104-239 [381549] Other proteins in same PDB: d6vd2a4, d6vd2b4 automated match to d1rg9a2 complexed with k, mg, mpo, pe8, peg, pge, po4, sam |
PDB Entry: 6vd2 (more details), 1.97 Å
SCOPe Domain Sequences for d6vd2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vd2a2 d.130.1.0 (A:104-239) automated matches {Arabidopsis thaliana [TaxId: 3702]} aqgvhghftkrpedigagdqghmfgyatdetpelmplshvlatkigarltevrkngtcrw lrpdgktqvtveyyndngamvpvrvhtvlistqhdetvtndeiardlkehvikpiipeky lddktifhlnpsgrfv
Timeline for d6vd2a2:
View in 3D Domains from other chains: (mouse over for more information) d6vd2b1, d6vd2b2, d6vd2b3, d6vd2b4 |