Lineage for d6rh7d_ (6rh7 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2463695Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2464082Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2464083Protein automated matches [190131] (84 species)
    not a true protein
  7. 2464408Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries)
  8. 2464431Domain d6rh7d_: 6rh7 D: [381120]
    Other proteins in same PDB: d6rh7a1, d6rh7a2, d6rh7b1, d6rh7b2
    automated match to d3dgec_
    complexed with adp, so4; mutant

Details for d6rh7d_

PDB Entry: 6rh7 (more details), 2 Å

PDB Description: revisiting ph-gated conformational switch. complex hk853 mutant h260a -rr468 mutant d53a ph 7.5
PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d6rh7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rh7d_ c.23.1.0 (D:) automated matches {Thermotoga maritima [TaxId: 2336]}
skkvllvddsavlrkivsfnlkkegyevieaengqialeklseftpdlivlaimmpvmdg
ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln

SCOPe Domain Coordinates for d6rh7d_:

Click to download the PDB-style file with coordinates for d6rh7d_.
(The format of our PDB-style files is described here.)

Timeline for d6rh7d_: