Lineage for d1a2ka_ (1a2k A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500605Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 500831Superfamily d.17.4: NTF2-like [54427] (12 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 500855Family d.17.4.2: NTF2-like [54431] (5 proteins)
  6. 500877Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 500890Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries)
  8. 500909Domain d1a2ka_: 1a2k A: [38100]
    Other proteins in same PDB: d1a2kc_, d1a2kd_, d1a2ke_

Details for d1a2ka_

PDB Entry: 1a2k (more details), 2.5 Å

PDB Description: gdpran-ntf2 complex

SCOP Domain Sequences for d1a2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2ka_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal
hnfg

SCOP Domain Coordinates for d1a2ka_:

Click to download the PDB-style file with coordinates for d1a2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1a2ka_: