Lineage for d1a2kd_ (1a2k D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484471Protein Ran [52609] (2 species)
  7. 484472Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries)
  8. 484483Domain d1a2kd_: 1a2k D: [32038]
    Other proteins in same PDB: d1a2ka_, d1a2kb_

Details for d1a2kd_

PDB Entry: 1a2k (more details), 2.5 Å

PDB Description: gdpran-ntf2 complex

SCOP Domain Sequences for d1a2kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2kd_ c.37.1.8 (D:) Ran {Dog (Canis familiaris)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqt

SCOP Domain Coordinates for d1a2kd_:

Click to download the PDB-style file with coordinates for d1a2kd_.
(The format of our PDB-style files is described here.)

Timeline for d1a2kd_: