Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (43 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries) |
Domain d1a2kd_: 1a2k D: [32038] Other proteins in same PDB: d1a2ka_, d1a2kb_ |
PDB Entry: 1a2k (more details), 2.5 Å
SCOP Domain Sequences for d1a2kd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2kd_ c.37.1.8 (D:) Ran {Dog (Canis familiaris)} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlevaqt
Timeline for d1a2kd_:
View in 3D Domains from other chains: (mouse over for more information) d1a2ka_, d1a2kb_, d1a2kc_, d1a2ke_ |