SCOPe 2.07: Domain d1askb_: 1ask B:

Lineage for d1askb_ (1ask B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (11 PDB entries)
   Uniprot P61972

8. Domain d1askb_: 1ask B: [38095]
   mutant

Details for d1askb_

PDB Entry: 1ask, 2.3 Å

PDB Description: nuclear transport factor 2 (ntf2) h66a mutant

PDB Compounds: (B:) nuclear transport factor 2

SCOPe Domain Sequences for d1askb_:

Sequence; same for both SEQRES and ATOM records:

>d1askb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqasitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal

Timeline for d1askb_:

• d1askb_ first appeared (with stable ids) in SCOP 1.55
  
• d1askb_ appears in SCOPe 2.06
  
• d1askb_ appears in the current release, SCOPe 2.08