SCOP 1.61: Domain d1askb_: 1ask B:

Lineage for d1askb_ (1ask B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.4: NTF2-like [54427] (4 families)

5. Family d.17.4.2: NTF2-like [54431] (3 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries)

8. Domain d1askb_: 1ask B: [38095]

Details for d1askb_

PDB Entry: 1ask, 2.3 Å

PDB Description: nuclear transport factor 2 (ntf2) h66a mutant

SCOP Domain Sequences for d1askb_:

Sequence; same for both SEQRES and ATOM records:

>d1askb_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqasitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrlal

Timeline for d1askb_:

• d1askb_ first appeared (with stable ids) in SCOP 1.55
  
• d1askb_ appears in SCOP 1.59
  
• d1askb_ appears in SCOP 1.63
  
• d1askb_ appears in the current release, SCOPe 2.08