Lineage for d3stdc_ (3std C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936288Family d.17.4.1: Scytalone dehydratase [54428] (1 protein)
    automatically mapped to Pfam PF02982
  6. 2936289Protein Scytalone dehydratase [54429] (1 species)
  7. 2936290Species Fungus (Magnaporthe grisea) [TaxId:148305] [54430] (8 PDB entries)
  8. 2936296Domain d3stdc_: 3std C: [38075]
    complexed with ca, mq0

Details for d3stdc_

PDB Entry: 3std (more details), 1.65 Å

PDB Description: scytalone dehydratase and cyanocinnoline inhibitor
PDB Compounds: (C:) protein (scytalone dehydratase)

SCOPe Domain Sequences for d3stdc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stdc_ d.17.4.1 (C:) Scytalone dehydratase {Fungus (Magnaporthe grisea) [TaxId: 148305]}
geitfsdylglmtcvyewadsydskdwdrlrkviaptlridyrsfldklweampaeefvg
mvsskqvlgdptlrtqhfiggtrwekvsedevigyhqlrvphqrykdttmkevtmkghah
sanlhwykkidgvwkfaglkpdirwgefdfdrifedgretfg

SCOPe Domain Coordinates for d3stdc_:

Click to download the PDB-style file with coordinates for d3stdc_.
(The format of our PDB-style files is described here.)

Timeline for d3stdc_: