Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Escherichia coli [TaxId:562] [226145] (21 PDB entries) |
Domain d6kxia1: 6kxi A:29-270 [380674] Other proteins in same PDB: d6kxia2 automated match to d5zh1b_ complexed with no9, so4, zn |
PDB Entry: 6kxi (more details), 1.38 Å
SCOPe Domain Sequences for d6kxia1:
Sequence, based on SEQRES records: (download)
>d6kxia1 d.157.1.0 (A:29-270) automated matches {Escherichia coli [TaxId: 562]} geirptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlv vdtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnql apqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggc likdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadk lr
>d6kxia1 d.157.1.0 (A:29-270) automated matches {Escherichia coli [TaxId: 562]} getgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqt aqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaq hsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskaksl gnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr
Timeline for d6kxia1: