SCOPe 2.08: Domain d6jh8a1: 6jh8 A:5-146

Lineage for d6jh8a1 (6jh8 A:5-146)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (13 PDB entries)

8. Domain d6jh8a1: 6jh8 A:5-146 [380629]
   Other proteins in same PDB: d6jh8a2
   automated match to d1c0fa1
   complexed with atp, ca; mutant

Details for d6jh8a1

PDB Entry: 6jh8, 2.15 Å

PDB Description: crystal structure of an actin monomer in complex with a chimeric peptide of cordon-bleu wh2 mutant and mim.

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6jh8a1:

Sequence, based on SEQRES records:

>d6jh8a1 c.55.1.0 (A:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqsdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6jh8a1 c.55.1.0 (A:5-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprsdsyvgdeaqskrgiltlkypiehg
iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
aiqavlslyasg

Timeline for d6jh8a1:

• d6jh8a1 first appeared in SCOPe 2.07