PDB entry 6jh8

View 6jh8 on RCSB PDB site
Description: Crystal structure of an actin monomer in complex with a chimeric peptide of Cordon-Bleu WH2 mutant and MIM.
Class: structural protein/protein binding
Keywords: WH2, actin, sequestering, PROTEIN BINDING, STRUCTURAL PROTEIN-PROTEIN BINDING complex
Deposited on 2019-02-17, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin, alpha skeletal muscle
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68135 (Start-376)
      • conflict (51)
    Domains in SCOPe 2.08: d6jh8a1, d6jh8a2
  • Chain 'B':
    Compound: Cordon-Bleu MIM chimeric peptide
    Species: Mus musculus [TaxId:10090]
    Gene: Cobl, Kiaa0633
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5NBX1 (0-22)
      • conflict (0)
      • conflict (4)
      • conflict (11)
      • conflict (22)
    • PDB 6JH8 (23-28)
  • Heterogens: ATP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jh8A (A:)
    mcdedettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqsdsyvgdea
    qskrgiltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrek
    mtqimfetfnvpamyvaiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrl
    dlagrdltdylmkiltergysfvttaereivrdikeklcyvaldfenemataasssslek
    syelpdgqvitignerfrcpetlfqpsfigmesagihettynsimkcdidirkdlyannv
    msggttmypgiadrmqkeitalapstmkikiiapperkysvwiggsilaslstfqqmwit
    kqeydeagpsivhrkcf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh8A (A:)
    ttalvcdngsglvkagfagddapravfpsivgrprsdsyvgdeaqskrgiltlkypiehg
    iitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyv
    aiqavlslyasgrttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkilt
    ergysfvttaereivrdikeklcyvaldfenemataassssleksyelpdgqvitigner
    frcpetlfqpsfigmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmq
    keitalapstmkikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc
    f
    

  • Chain 'B':
    No sequence available.