Lineage for d6rhta_ (6rht A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437294Species Pediococcus acidilactici [TaxId:862514] [380520] (3 PDB entries)
  8. 2437295Domain d6rhta_: 6rht A: [380533]
    automated match to d4yl2a_
    complexed with fmn, gol

Details for d6rhta_

PDB Entry: 6rht (more details), 1.9 Å

PDB Description: structure of pediococcus acidilactici putative lactate oxidase wt protein
PDB Compounds: (A:) Putative L-lactate oxidase

SCOPe Domain Sequences for d6rhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rhta_ c.1.4.0 (A:) automated matches {Pediococcus acidilactici [TaxId: 862514]}
mtmingyeqsdreekidilnleslekqaeeiipaggfgyiaggsedewtlkqnrmafhhr
qiapkalsgiekpelnteifgiplntpvmmapaaaqglahsqgekdtarglaavgglmaq
styssvsiaetaaaggdapqffqlymskdwnfneslldeakkanvkaiiltvdatvdgyr
eadiknkftfplpmanlikfsegngqgkgieeiyasaaqnirpedvkriadytnlpvivk
giqtpedairaidagaagiyvsnhggrqlnggpasfdvlediatavnkqvpiifdsgvrr
gsdvfkalasgadlvalgrpviyglalggakgvqsvfehlnheleivmqlagtktiedvk
nnsllniky

SCOPe Domain Coordinates for d6rhta_:

Click to download the PDB-style file with coordinates for d6rhta_.
(The format of our PDB-style files is described here.)

Timeline for d6rhta_: