Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Pediococcus acidilactici [TaxId:862514] [380520] (3 PDB entries) |
Domain d6rhta_: 6rht A: [380533] automated match to d4yl2a_ complexed with fmn, gol |
PDB Entry: 6rht (more details), 1.9 Å
SCOPe Domain Sequences for d6rhta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rhta_ c.1.4.0 (A:) automated matches {Pediococcus acidilactici [TaxId: 862514]} mtmingyeqsdreekidilnleslekqaeeiipaggfgyiaggsedewtlkqnrmafhhr qiapkalsgiekpelnteifgiplntpvmmapaaaqglahsqgekdtarglaavgglmaq styssvsiaetaaaggdapqffqlymskdwnfneslldeakkanvkaiiltvdatvdgyr eadiknkftfplpmanlikfsegngqgkgieeiyasaaqnirpedvkriadytnlpvivk giqtpedairaidagaagiyvsnhggrqlnggpasfdvlediatavnkqvpiifdsgvrr gsdvfkalasgadlvalgrpviyglalggakgvqsvfehlnheleivmqlagtktiedvk nnsllniky
Timeline for d6rhta_: