![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.17: Cystatin-like [54402] (6 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [54421] (10 PDB entries) |
![]() | Domain d1avk_2: 1avk 9-96 [38047] Other proteins in same PDB: d1avk_1 |
PDB Entry: 1avk (more details), 2.2 Å
SCOP Domain Sequences for d1avk_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1avk_2 d.17.2.1 (9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d1avk_2: