Lineage for d1avk_2 (1avk 9-96)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 326290Fold d.17: Cystatin-like [54402] (6 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 326350Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 326351Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
    duplication: contains two domains of this fold
  6. 326352Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 326353Species Arthrobacter globiformis [TaxId:1665] [54421] (10 PDB entries)
  8. 326380Domain d1avk_2: 1avk 9-96 [38047]
    Other proteins in same PDB: d1avk_1

Details for d1avk_2

PDB Entry: 1avk (more details), 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone

SCOP Domain Sequences for d1avk_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avk_2 d.17.2.1 (9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

SCOP Domain Coordinates for d1avk_2:

Click to download the PDB-style file with coordinates for d1avk_2.
(The format of our PDB-style files is described here.)

Timeline for d1avk_2: