SCOP 1.55: Domain d1avk_2: 1avk 9-96

Lineage for d1avk_2 (1avk 9-96)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (3 PDB entries)

8. Domain d1avk_2: 1avk 9-96 [38047]
   Other proteins in same PDB: d1avk_1

Details for d1avk_2

PDB Entry: 1avk, 2.2 Å

PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone

SCOP Domain Sequences for d1avk_2:

Sequence; same for both SEQRES and ATOM records:

>d1avk_2 d.17.2.1 (9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d1avk_2:

• d1avk_2 appears in SCOP 1.57
  
• d1avk_2 appears in the current release, SCOPe 2.08, called d1avka2