| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins) |
| Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries) |
| Domain d6qlbc_: 6qlb C: [380067] Other proteins in same PDB: d6qlbe1, d6qlbe2, d6qlbf1, d6qlbf2, d6qlbg1, d6qlbg2, d6qlbh1, d6qlbh2 automated match to d1df0b_ protein/DNA complex; protein/RNA complex; complexed with ca, edo, gun, p4g |
PDB Entry: 6qlb (more details), 2.32 Å
SCOPe Domain Sequences for d6qlbc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6qlbc_ a.39.1.8 (C:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
Timeline for d6qlbc_: