Lineage for d6qlbc_ (6qlb C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2324637Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)
  6. 2324651Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2324652Species Human (Homo sapiens) [TaxId:9606] [47553] (10 PDB entries)
  8. 2324669Domain d6qlbc_: 6qlb C: [380067]
    Other proteins in same PDB: d6qlbe1, d6qlbe2, d6qlbf1, d6qlbf2, d6qlbg1, d6qlbg2, d6qlbh1, d6qlbh2
    automated match to d1df0b_
    protein/DNA complex; protein/RNA complex; complexed with ca, edo, gun, p4g

Details for d6qlbc_

PDB Entry: 6qlb (more details), 2.32 Å

PDB Description: calpain small subunit 1, rna-binding protein hfq
PDB Compounds: (C:) Calpain small subunit 1

SCOPe Domain Sequences for d6qlbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6qlbc_ a.39.1.8 (C:) Calpain small (regulatory) subunit (domain VI) {Human (Homo sapiens) [TaxId: 9606]}
eevrqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d6qlbc_:

Click to download the PDB-style file with coordinates for d6qlbc_.
(The format of our PDB-style files is described here.)

Timeline for d6qlbc_: